PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa10g010860.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 747aa    MW: 84139.1 Da    PI: 8.6516
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa10g010860.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B357.52.5e-182731896
                    --HHH.HTT..---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3 18 lpkkfaeeh..ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96
                    +p kf++eh  g+  +e++ + l +  s ++W+vk+  ++++    ltkGWkeFv+a++L++gDfvvF+++g++ f  +v++
  Csa10g010860.1  2 IPIKFFSEHtvGK--HEGRSVNLVSdASEKTWKVKM--EGHR----LTKGWKEFVEAHDLRVGDFVVFRHEGDMMF--HVTA 73
                    99*******7544..45556666654999*******..6666....***********************9998888..6665 PP

2B3741.7e-23114208399
                     EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                     +  +++++l+++ +++p +fa+++g+ ke+ ++++l++e+g+sWe  ++ +++  r  + +GW +F++an+L++gDf++F+l  ++ +++v+k++
  Csa10g010860.1 114 SLSVTESNLSRDTVCVPINFAKRNGLGKER-QEIVLMNEEGKSWESVVKSWGGC-RLSIVRGWTSFCNANKLEVGDFCTFRLLPNTAETPVFKLC 206
                     5678999*****************998877.5****************888885.788999*********************9999999****** PP

                     -S CS
              B3  98 rk 99 
                     ++
  Csa10g010860.1 207 SR 208
                     98 PP

3B344.52.8e-14231327197
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTE.EEE-..TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgr.yvlt..kGWkeFvkangLkegDfvvFkldgrsefel 92 
                     f+k +++ ++l  g   lp +f++e+g+++++  +++l d++  +W ++l+++k+ g  y+++  +GWk+F+ an++ +g++++++l++  + ++
  Csa10g010860.1 231 FVKLTLTRNSLHIGKQHLPVRFTRENGHINPG--KIILVDKNRSEWPMNLKVDKSTGLmYIISgnNGWKSFCAANEIGAGESLTLELIR-GGVTP 322
                     77888889999999999*********999655..8***************9988887755555779*********************98.67777 PP

                     EEEEE CS
              B3  93 vvkvf 97 
                     ++k+ 
  Csa10g010860.1 323 LLKFS 327
                     77766 PP

4B332.12.1e-105586352099
                     HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTE.EEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3  20 kkfaeehggkkeesktltledesgrsWevkliyrkksgr.yvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                     k f + ++++   s+ ++l d++  +W +kl+++ ++ + ++ +  Wk+F+ an++ +g++++++l++  ++++++k+++k
  Csa10g010860.1 558 KCFSRVNMLN--MSRNIILVDKDKVEWLMKLKVDSRGAMtIYGRHDWKSFCAANEVGAGESMTLELIR-GGTSPFLKFCSK 635
                     5566566666..4568***************8855554459999**********************98.788899999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.108.9E-21179IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.847177IPR003340B3 DNA binding domain
SMARTSM010193.5E-11277IPR003340B3 DNA binding domain
SuperFamilySSF1019361.0E-18283IPR015300DNA-binding pseudobarrel domain
PfamPF023625.7E-13269IPR003340B3 DNA binding domain
CDDcd100178.12E-16272No hitNo description
Gene3DG3DSA:2.40.330.103.6E-21107206IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.85E-22108209IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.607112209IPR003340B3 DNA binding domain
CDDcd100174.72E-20112202No hitNo description
SMARTSM010191.9E-26113209IPR003340B3 DNA binding domain
PfamPF023622.0E-22113208IPR003340B3 DNA binding domain
CDDcd100171.43E-16229326No hitNo description
SMARTSM010191.2E-24231330IPR003340B3 DNA binding domain
SuperFamilySSF1019368.04E-17231332IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.211231329IPR003340B3 DNA binding domain
PfamPF023621.2E-13231328IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.4E-15231329IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5096718.236459541IPR002121HRDC domain
SMARTSM003416.6E-4459541IPR002121HRDC domain
Gene3DG3DSA:1.10.150.802.1E-11462537IPR002121HRDC domain
SuperFamilySSF478193.05E-13462537IPR010997HRDC-like
PfamPF005704.8E-14464531IPR002121HRDC domain
PROSITE profilePS5086310.024539635IPR003340B3 DNA binding domain
SMARTSM010191.9E-12543636IPR003340B3 DNA binding domain
SuperFamilySSF1019361.67E-11547635IPR015300DNA-binding pseudobarrel domain
CDDcd100177.55E-9555634No hitNo description
Gene3DG3DSA:2.40.330.107.0E-10555635IPR015300DNA-binding pseudobarrel domain
PfamPF023623.2E-9556635IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0044237Biological Processcellular metabolic process
GO:0005622Cellular Componentintracellular
GO:0000166Molecular Functionnucleotide binding
GO:0003677Molecular FunctionDNA binding
GO:0003824Molecular Functioncatalytic activity
Sequence ? help Back to Top
Protein Sequence    Length: 747 aa     Download sequence    Send to blast
NIPIKFFSEH TVGKHEGRSV NLVSDASEKT WKVKMEGHRL TKGWKEFVEA HDLRVGDFVV  60
FRHEGDMMFH VTALGSSCCE IQYAQESNET DMSSRSEKQV KENVKTDSDL NCFSLSVTES  120
NLSRDTVCVP INFAKRNGLG KERQEIVLMN EEGKSWESVV KSWGGCRLSI VRGWTSFCNA  180
NKLEVGDFCT FRLLPNTAET PVFKLCSRTM SERTVQSAEG CIDGETVGKR FVKLTLTRNS  240
LHIGKQHLPV RFTRENGHIN PGKIILVDKN RSEWPMNLKV DKSTGLMYII SGNNGWKSFC  300
AANEIGAGES LTLELIRGGV TPLLKFSSKM EQPPFEAEAR EHKRARVQRW SQETEPKVEM  360
REKTAEELGE PSRASHKSCG NQENLQHTQA CSVSNQVAKV KQSVVDALTS VKRFMAELET  420
TEQKLEISLQ EINNLGPPTS EKQSTLPVLP TEYGPPKDLN LSNNIFIALR KLRSDLVKEA  480
PDGVMAYHIF MNSTLLQISR QIPRTKEELL GISGLGEAKV KEYGDRLLET IESTVKEYYV  540
ELIRKIPSSA TRVPYLGKCF SRVNMLNMSR NIILVDKDKV EWLMKLKVDS RGAMTIYGRH  600
DWKSFCAANE VGAGESMTLE LIRGGTSPFL KFCSKMKKPT FEAEDGIRKK APVQIQNGGQ  660
ETDKGEPSRE SNKSRGDQGN LQQTQTLSVK DQVAKVKESV VDTLTSIRRF LTEFETKEQE  720
LQDSKWGEEK TMGTRQDLRV IIKLKM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010451094.10.0PREDICTED: B3 domain-containing protein REM8-like
SwissprotQ8H2D10.0REM8_ARATH; B3 domain-containing protein REM8
TrEMBLD7MB410.0D7MB41_ARALL; Putative uncharacterized protein
STRINGscaffold_701042.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20422261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31680.10.0B3 family protein